PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_19852_BGI-A2_v1.0
Common NameF383_29570
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 326aa    MW: 36493.8 Da    PI: 6.77
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_19852_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding537.7e-171461148
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
             Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                +g+WT+eEd  lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  Cotton_A_19852_BGI-A2_v1.0 14 KGPWTPEEDIVLVSYIQEHGPGNWRAVPTNTGLLRCSKSCRLRWTNYL 61
                                79******************************99************97 PP

2Myb_DNA-binding49.69.3e-1667112148
                                 TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
             Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                 rg++T+ E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Cotton_A_19852_BGI-A2_v1.0  67 RGNFTEHEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                                 89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-22564IPR009057Homeodomain-like
PROSITE profilePS5129423.934965IPR017930Myb domain
SuperFamilySSF466891.36E-3011108IPR009057Homeodomain-like
SMARTSM007171.5E-131363IPR001005SANT/Myb domain
PfamPF002491.8E-151461IPR001005SANT/Myb domain
CDDcd001677.34E-111661No hitNo description
Gene3DG3DSA:1.10.10.601.5E-2465117IPR009057Homeodomain-like
PROSITE profilePS5129419.45166116IPR017930Myb domain
SMARTSM007173.4E-1566114IPR001005SANT/Myb domain
PfamPF002492.4E-1467112IPR001005SANT/Myb domain
CDDcd001676.45E-1169111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009617Biological Processresponse to bacterium
GO:0009626Biological Processplant-type hypersensitive response
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042761Biological Processvery long-chain fatty acid biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MGRPPCCDKV GVKKGPWTPE EDIVLVSYIQ EHGPGNWRAV PTNTGLLRCS KSCRLRWTNY  60
LRPGIRRGNF TEHEEKMIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLKKLH  120
GSEGYCRDGF PSSAASDQIS RGQWERKLQT DINMAKQALS DALSPEKSSD LAELKPCHGN  180
TYAKPEGYAS STENIAKLLK GWMRKNPLKP ASTNSGVTQQ SYDNMAATGV TTDSANSSEG  240
NDQRCSKPIC EGFESLFVFE SFDSSNSDDF SQSMSTEASL SLQDETKPDL SPQLSLLEKW  300
LFDDAANQGK YYQLSDITLD ENPSFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-25141164105C-Myb DNA-Binding Domain
1msf_C2e-25141164105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00386DAPTransfer from AT3G28910Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012460698.10.0PREDICTED: myb-related protein 306-like
SwissprotP813921e-121MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0B0MYG80.0A0A0B0MYG8_G
STRINGPOPTR_0004s12530.11e-141(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58422348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.11e-107myb domain protein 30